PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00108.1_g00044.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 250aa    MW: 27668.8 Da    PI: 9.8173
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00108.1_g00044.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof102.23.1e-322177561
                   zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                              + cprC s+ntkfC+ynnys+sqPry C++Crr+Wt+GGalr++P+Gg +rk k++
  Rsa1.0_00108.1_g00044.1 21 PRVCPRCISDNTKFCFYNNYSVSQPRYNCRNCRRFWTHGGALRDIPIGGRARKIKRK 77
                             678**************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-221676IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.9652276IPR003851Zinc finger, Dof-type
PfamPF027012.0E-292276IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MKKLNVIVKG NHQVNEEKPP PRVCPRCISD NTKFCFYNNY SVSQPRYNCR NCRRFWTHGG  60
ALRDIPIGGR ARKIKRKGID QPSVSQVVSV VQQVNNHQPF SHAQETNEFL GTFGGSSSSS  120
SSVAVVANHF SSSTEPNGVM ALPIRSIPPM DRFDGSFNQG YYGAGFNDLV GNPLMNQSFG  180
GHVGNYNSYF VNQEDPNKGN QSFNNSMNMN HNASTSGSRG YPGTDHMINN NKVGNKCVFK  240
SSYHLEKHGP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013594517.11e-148PREDICTED: dof zinc finger protein DOF4.4-like
RefseqXP_013681996.11e-148PREDICTED: dof zinc finger protein DOF4.4-like
SwissprotQ9SUA91e-72DOF44_ARATH; Dof zinc finger protein DOF4.4
TrEMBLA0A078JWI51e-148A0A078JWI5_BRANA; BnaUnng03510D protein
TrEMBLA0A0D3A4Q51e-148A0A0D3A4Q5_BRAOL; Uncharacterized protein
STRINGBra013493.1-P1e-145(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21050.13e-60Dof-type zinc finger domain-containing protein